PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00008g00498.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family G2-like
Protein Properties Length: 344aa    MW: 38518.3 Da    PI: 8.4832
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00008g00498.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.26.7e-32128181255
                   G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                               pr+rWt++LH++Fv+av+ LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  Peaxi162Scf00008g00498.1 128 PRMRWTSTLHAHFVHAVQLLGGHERATPKSVLELMNVKDLTLAHVKSHLQMYRT 181
                               9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.69E-15126182IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.6E-28126182IPR009057Homeodomain-like
TIGRFAMsTIGR015578.3E-24128181IPR006447Myb domain, plants
PfamPF002495.8E-7129180IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0080060Biological Processintegument development
GO:0005618Cellular Componentcell wall
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 344 aa     Download sequence    Send to blast
MTEASSTMPD LSLQISLSSN IPTCDKFKQV LGFNRFTKSS SVVNNHSSDS GSSGSDLSQE  60
NGLFQPEKSF NVSLIPSVEP TLSLGFAQLP SRNLHHQQYQ HFQPQIYGRD FKRNSRMISG  120
VKRSCRAPRM RWTSTLHAHF VHAVQLLGGH ERATPKSVLE LMNVKDLTLA HVKSHLQMYR  180
TVKSTDKSTA KGRTEIFLNP NYKGNIAEYE NSCEEAYTIT DPSVSLSNTI PQNAHIIRAP  240
SSFMPETNAW SHSIRETAFP YHHIYSNGSR SICLCINVMY LDFMQMNGIE IANHMSEKKE  300
TMDSSRGSSL NSSSSDTLVN LEFTLGRTSS NMGHAKTMDH VDFN
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00107PBMTransfer from AT5G42630Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009804553.11e-128PREDICTED: probable transcription factor KAN4 isoform X1
TrEMBLK4BV431e-112K4BV43_SOLLC; Uncharacterized protein
STRINGSolyc04g079600.2.11e-111(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA122621822
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G42630.24e-57G2-like family protein